Recombinant Human Collectin-11 (COLEC11)

In Stock
Code CSB-MP861154HU
MSDS
Size $660
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP861154HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP861154HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
COLEC11
Uniprot No.
Research Area
Cell Biology
Alternative Names
CL K1; CL K1 I; CL K1 II; CL K1 IIa; CL K1 IIb; CL-K1; CLK1; COL11_HUMAN; COLEC 11; COLEC11; Collectin 11; Collectin kidney I; Collectin kidney protein 1; Collectin sub family member 11; Collectin-11; Collectin11; DKFZp686N1868; MGC129470; MGC129471; MGC3279
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-271aa
Target Protein Sequence
QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
30.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To make this Recombinant Human COLEC11 protein, the COLEC11 gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human COLEC11 protein was developed in the platform. It was expressed in Mammalian cell at the region of 26-271aa of the Human COLEC11 protein. N-terminal 10xHis tag and C-terminal Myc tag was fused with the expression vector for affinity and purification purposes. The purity is 90%+ determined by SDS-PAGE.

The gene encoding collectin-11, COLEC11, is located on chromosome 2p25.3 (OMIM 612502) and comprises 7 exons that transcribe the canonical protein. COLEC11 variability was shown to interfere with expression and also with the binding of calcium and carbohydrates, possibly affecting protein folding. Collectin-11 shows a strong binding affinity to fucose-proteins, as found in the Tc-85 protein family, expressed on the surface of T. cruzi metacyclic trypomastigotes. Those proteins are involved in the entry of the parasite to host cells. In addition, collectin-11 is structurally similar to MBL and it has been shown that both MBL levels and MBL2 genetic variants were associated with disease susceptibility and pathophysiology of CD. Considering these observations, collectin-11 plasma levels and COLEC11 variants in exon 7 were assessed to investigate their potential role in the chronic CD. Moreover, on account of the interaction between collectin-11 and MASPs for complement activation, gene-gene interaction between COLEC11 and MASP2 was assessed to evaluate the additive genetic effect of the two loci and their role in the pathophysiology of this chronic disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis.
Gene References into Functions
  1. this study demonstrates the role of CL-11 and the molecular mechanisms involved in modulating retinal pigment epithelial cell phagocytosis and cytokine production PMID: 28772263
  2. High CLK1 expression is associated with cardiovascular disease. PMID: 27341702
  3. The exclusion of the MASP1 and COLEC11 Loci in two individuals from different consanguineous families and the absence of mutations in four further individuals sequenced for both genes raises the possibility that that there is further genetic heterogeneity of 3MC syndrome PMID: 26789649
  4. identify collectin CL-LK as a novel soluble C-type lectin able to bind M. tuberculosis, and characterize mycobacterial mannose-capped lipoarabinomannan as a primary ligand for CL-LK PMID: 26173080
  5. Data indicate differences in the plasma concentrations of collectin liver 1 and collectin kidney 1, M-ficolin and H-ficol in systemic lupus erythematosus (SLE) patients compared to a group of healthy controls. PMID: 26154564
  6. promoter polymorphism COLEC11-9570C>T (rs3820897) was associated with decreased levels of CL-K1. PMID: 25710878
  7. the sugar specificity of CL-K1 was established. PMID: 25912189
  8. These results suggest that specific diseases may affect CL-K1 synthesis in an organ dependent manner and that elevated plasma CL-K1 levels are associated with the presence of DIC. PMID: 24474086
  9. Most plasma CL-K1 was found in complex with CL-L1 in a ratio suggesting a heteromeric subunit of 1 CL-L1 & 2 CL-K1 polypeptides. It associated with MASPs 1, 2 & 3. On binding mannan or DNA in the presence of MASP-2, the complex deposited C4b. PMID: 24174618
  10. Data suggest that collectin 11 (CL-11), e.g. via complement, may play a role in response to particles and surfaces presenting extracellular DNA, such as apopototic cells. PMID: 23954398
  11. collectin-11 associates with all the known MBL-associated serine proteases (MASP-1, MASP-2 and MASP-3) as well as the lectin complement pathway regulator MAP-1. PMID: 23220946
  12. Data show that the concentration of collectin kidney 1 (CL-K1, COLEC11) in plasma was 0.34 +/- 0.13 microg/ml and that in mannan-binding lectin (MBL) was 1.72 +/- 1.51 microg/ml. PMID: 21893516
  13. these findings demonstrate a role for complement pathway factors in fundamental developmental processes and in the etiology of 3MC syndrome. PMID: 21258343
  14. CL-11 plays a role in activation of the complement system and in the defense against invading microorganisms PMID: 20956340

Show More

Hide All

Involvement in disease
3MC syndrome 2 (3MC2)
Subcellular Location
Secreted.
Protein Families
COLEC10/COLEC11 family
Tissue Specificity
Ubiquitous. Detected in adrenal gland, kidney, liver, ovaries and testis (at protein level).
Database Links

HGNC: 17213

OMIM: 265050

KEGG: hsa:78989

STRING: 9606.ENSP00000339168

UniGene: Hs.32603

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*